DPCstruct | MC57715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V0DFR1 | 1-94 | MSDITQLLVAAREGDTDAGDRLLPLVYDHLHQIAHRQLRRMRVHETLNTTALVHEAYLKLVQHTRVTYEDRVHFFAVSARAMRFILV… |
| A0A517NCQ8 | 1-94 | MDDVTQILEQIERGDPTAPDQLMPLVYSELRRLAAAKIARESAGHTLQATALVHEAYVRLVGSVPDRSFSDRRHFFAAAATAMKRIL… |
| A0A7V4M122 | 1-83 | None |
| A0A6A7KXI9 | 20-118 | None |
| A0A518BS24 | 1-118 | None |
| A0A3E0P9Q3 | 32-128 | None |
| A0A517XN59 | 1-91 | None |
| A0A5C1ASY4 | 75-140 | None |
| A0A1G6VL62 | 7-114 | None |
| A0A7V9PJB9 | 14-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.