DPCstruct | MC57714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 342 |
|---|---|
| Mean domain length (aa) | 282 ± 58 aa |
| Standard deviation of domain lengths | 57.51 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 16.01 |
| Pfam Score | 96.76 |
| Assigned Pfam label(s) | PF07159- CL0159- CL0727- CL0016- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V0DC75 | 21-287 | MWPGASTGRPLLIDADTANEIDDLYAIVWTLLQPDADVIGLSSAQWNHRLSPPDTVRQSQRINEDLLHLLGRRDIPHPLGAEMIMGK… |
| A0A1F8PHL3 | 14-211 | TPERSPAALDLVKRAMEAPEDSPLYVVGIGAITNVASAILIEPDIIRRIVVVWLGGQPHSFHTAQEYNLKQDPLASKTLFDCGVPLV… |
| A0A5C5ZA69 | 274-621 | None |
| A0A1Z5TFA2 | 8-253 | None |
| A0A420N5Z3 | 19-226 | None |
| A0A6P5N3E4 | 7-259 | None |
| A0A3A9W741 | 1-290 | None |
| R1D490 | 292-534 | None |
| A0A815F1L8 | 4-202 | None |
| A0A5C5Z3Y3 | 634-987 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.