DPCstruct | MC57713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 332 ± 51 aa |
| Standard deviation of domain lengths | 50.92 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.31 |
| Pfam Score | 69.05 |
| Assigned Pfam label(s) | CL0244- PF00691 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V0DAB7 | 19-354 | LWTGRPHRVRVKTRYRAYLLEVEDVNFHHDSAVFLPDYEPPDEPSGTDAQNRLIGLAVVKACYEHARYRPGASALVVGHTDRSGDAA… |
| A0A495DCB9 | 246-482 | VAKTFMIHFRFDSAFVEPCMMHVLKQVAEFSSANSSDKFLVVGHTDLSGSTAYNQSLSERRARSSFSALRFGNDNQAAVDEWNAIRR… |
| A0A4Q5XBC3 | 444-765 | None |
| A0A0C1ZIH7 | 187-524 | None |
| A0A356KVV5 | 193-519 | None |
| A0A661P7I0 | 329-623 | None |
| A0A2S9YM70 | 4-422 | None |
| A0A2W4LZL0 | 1-323 | None |
| A0A1F8ZS26 | 10-357 | None |
| A0A150QSQ5 | 144-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.