DPCstruct | MC57710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 257 ± 23 aa |
| Standard deviation of domain lengths | 22.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2T6I9 | 1-305 | MSMRRNAKDERVLFHYNGHGVPRPTQNGEIWVFNKNFTQYIPLSLYDLQLCMEFPSIYVWDCSSAETIVNWFMRFAKDHEEWVMVDI… |
| R8BRD0 | 242-489 | SLRRNAKDERVLLHYNGHGVPKPTASGEIWVFNKNYTQYIPVSLYDLQHWLQAPTIFVWDCSEAGNILNNYHRFVEKHEQEEEEAAS… |
| A0A2H2JLR4 | 4-251 | None |
| A0A821AZ56 | 1-208 | None |
| A0A0N5ASJ5 | 177-410 | None |
| A0A5K3FV06 | 111-357 | None |
| R1F787 | 194-447 | None |
| A0A7J6UAU7 | 147-444 | None |
| A0A060WV05 | 1-242 | None |
| Q68TI8 | 176-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.