DPCstruct | MC5771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 144 ± 27 aa |
| Standard deviation of domain lengths | 26.93 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F3PA97 | 2-97 | FNHDKENRWCLDCHDFNNRDSLRLASGKLLDFKESYKLCGQCHGEKYRDWKVGVHGKRTGEWNGKKEYLLCVHCHNPHSPKFQELTP… |
| A0A539EQ47 | 32-187 | DGIAPLKPEYSDPATVRKVPTKMLFDGAPCASCHEGLEPNTGNPKEKGVFHEAKKLQHGRNQHCFNCHHRADPTDFANFDGSPIKLA… |
| A0A356TEF7 | 2-111 | None |
| A0A1G3XVG6 | 18-192 | None |
| A0A518CSY0 | 66-251 | None |
| A0A5C6TZ56 | 528-657 | None |
| A0A2M6XY13 | 115-254 | None |
| A0A496XQX5 | 19-155 | None |
| A0A6I1JXR8 | 76-241 | None |
| A0A3M2B2T0 | 84-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.