DPCstruct | MC57702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 155 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2SXH0 | 1-169 | MACIEGVAGATSDQLEALGGGEILRQEAGSFTNARNKRASARLRDAVMMGDTAIALCILIAQQRECVVYRESSRLPLKLIGEMVDQC… |
| A0A835RQ69 | 84-225 | MANVQYTENMTEEQLDAMAGSETLRFQATLFGMTRNNKALSRSTVRLRDSLLPKEDPKLAIPLLLLIAQHRSMIVIHADAPYIKMVS… |
| A0A2H2J5A2 | 11-165 | None |
| A0A5K3FWX9 | 375-531 | None |
| A0A1I8GXX4 | 301-464 | None |
| F4NSU7 | 831-983 | None |
| A0A818MI63 | 67-213 | None |
| A0A4Z0A8H5 | 3-150 | None |
| A0A6J0YTY1 | 686-829 | None |
| A0A814TPF0 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.