DPCstruct | MC577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 62 ± 3 aa |
| Standard deviation of domain lengths | 3.22 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 75.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00787 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820NJ64 | 64-126 | VFNVYIAGRHLCSRRYREFDSLHQLLKQEYPDFPFSPLPKKWPFKLSDQQLDTRRRGLEQYIE |
| A0A819IZT9 | 11-68 | IAGRHLCSRRYREFDSLHQQLKNEFPDFPFSPLPKKWPFKLSDQQLDARRRGLEQYLD |
| A0A1I8IAV1 | 517-581 | None |
| A0A7R5KFE1 | 83-148 | None |
| A0A7R9J5N3 | 134-195 | None |
| A0A0R3RFC7 | 327-390 | None |
| T1H0F5 | 88-149 | None |
| A0A2G8L5G3 | 84-148 | None |
| A0A653D6M9 | 162-225 | None |
| A0A3Q0FLU9 | 91-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.