DPCstruct | MC57698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 68 ± 2 aa |
| Standard deviation of domain lengths | 2.25 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 90.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 55.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2SST2 | 1-64 | MNHLKDYQVQCGNYHLLTFADEFAIGYFSKQGFSANVEMPKKLYHGYIKEYEGATLMGCQLHPQ |
| A0A0C2HCP1 | 55-122 | VKGYGTHLMNHLKDYQVQCGNYHLLTFADEFAIGYFSKQGFSANVEMPKKLYHGYIKEYEGATLMGCQ |
| A0A1D2N899 | 120-187 | None |
| A0A6I9VRN9 | 1-62 | None |
| A0A0K6GAA0 | 415-484 | None |
| A0A7S0GQ06 | 166-236 | None |
| A0A7S1PHL6 | 298-363 | None |
| A0A183LFV9 | 1-61 | None |
| A0A061D510 | 345-412 | None |
| A0A4C1VYP2 | 121-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.