DPCstruct | MC57697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 16.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.39 |
| Pfam Score | 71.79 |
| Assigned Pfam label(s) | CL0229- CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2SR91 | 4-140 | YALSPSKAVKHIFIQFRMEHPDKWNWTRCHIPEPIQMNDEKAAKVAEKKKEKKQRQKEKTKIKKEAEKKEAEELAARAAFLAMSDRE… |
| A0A0W8DQ88 | 2-151 | VEYLLEQGANPALLDLHNRPPYFLCNSKESRNAFRRYMGKHPYAWDYSTAQIPEGLTSEMEQRKKEKEAEKRKRARERKKQQKKEAA… |
| A0A7S1SHX5 | 6-165 | None |
| A0A2T7PBG2 | 659-808 | None |
| A0A674GCE0 | 624-758 | None |
| A4S9T4 | 142-279 | None |
| A0A7S1UKG3 | 246-412 | None |
| K2SNE3 | 414-569 | None |
| A0A396H2T1 | 289-448 | None |
| A0A2G5ULN8 | 878-1018 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.