DPCstruct | MC57696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 180 ± 25 aa |
| Standard deviation of domain lengths | 25.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4V1X6 | 441-598 | NSSELVTAVALRCLYSGEVRGLQAAGTDGQLATQLKATWTRKDDAAHSPALLRVTAQLISTPGLDRELLHLVAWSPAIMFTEPAMRT… |
| W2SR53 | 2-178 | DAVINAGSDNTSMYLSSLHMRSMYLGQVKGMLALCAADDDETPECTLIRRLEVDFEAAIKCGCDEKLKNAIMLLTALFVTLKNVNEH… |
| A0A7R9HL73 | 123-285 | None |
| A0A3P7EVW6 | 1014-1183 | None |
| A0A1U8F034 | 1-250 | None |
| A0A498SEZ0 | 386-561 | None |
| A0A0C3LN04 | 524-718 | None |
| A0A811XAB4 | 502-665 | None |
| A0A820VG19 | 1-179 | None |
| A0A6A0H7Y8 | 204-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.