DPCstruct | MC57694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 112 ± 17 aa |
| Standard deviation of domain lengths | 17.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8D4W1 | 1-134 | MKVRRDSEAQFHMSKVARDGFARTGRGSVNFRINTVSKAKQYLNAGWEVFNGIDYKSLLFYYPIQALENQQKEQSLIKLCKQYNAKE… |
| A0A139WAK0 | 97-201 | VIASIKEQKETLYHLSLIARRGYLSHGLGAVKCFFPGPDKADKFLTGGLNDLGELTYVRWPDLLPSEMGPQLYSELVQMCKTYNPDT… |
| A0A7E4RV19 | 202-308 | None |
| A0A0N5B041 | 1-84 | None |
| A0A6P3R515 | 423-532 | None |
| A0A4Z2J8G9 | 62-171 | None |
| A0A1S3G7Z3 | 386-521 | None |
| A0A0N5BXD6 | 586-697 | None |
| A0A1I7ZWR7 | 100-231 | None |
| A0A158Q9R8 | 174-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.