DPCstruct | MC57690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 197 |
|---|---|
| Mean domain length (aa) | 224 ± 37 aa |
| Standard deviation of domain lengths | 36.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.03 |
| Pfam Score | 99.03 |
| Assigned Pfam label(s) | CL0412- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2MUQ2 | 2-182 | IFIGCAQFLIMLVVSSSLYPGYSISHNYISDLGATCRGSSCIVFQPSSVIFNTSVSLLGYLLVVASILLARSGSKGIFASLLLISGL… |
| L1IU26 | 10-256 | CHFEEQPLTRTRGQLEAKHVPLLAAVLGVSSILVPVLSHIAQGKQPPYPTISMTAYMPGSFEYFVFASGLCTTASLLILTAIIVRWR… |
| A0A2G8L475 | 4-193 | None |
| A0A3S0ZH71 | 190-406 | None |
| A0A1Q9C4U6 | 217-504 | None |
| A0A6G0XG59 | 211-492 | None |
| V4BRN7 | 57-257 | None |
| A0A7R8X1U6 | 18-263 | None |
| A0A524I0M0 | 6-171 | None |
| A0A842QIA9 | 80-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.