DPCstruct | MC5769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3WXX6 | 267-337 | SEKEFTVRTEYDSASNLIYYGEAEPGSLESEAKWRIKKITWSGSLLVDIKWANGDALFTKVWNDRATYNYS |
| A0A3D2PD20 | 73-139 | VTKIMYVDEPDANTTYQGWATAGTATSAASWMIRKIAKSGNVTSILWADGNQNYDNIWDNRTTLSYS |
| A0A7X7LKJ4 | 13-80 | None |
| A0A2N2RB47 | 156-226 | None |
| A0A420Z1D4 | 38-106 | None |
| A0A364NT49 | 68-146 | None |
| A0A0S7XPM4 | 5-73 | None |
| A0A1G2UIS0 | 211-276 | None |
| X1U2X0 | 39-130 | None |
| A0A6M3XAK8 | 16-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.