DPCstruct | MC5768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 150 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 10.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0KDK4 | 2-83 | VTKEVKIKNQTGLHARPAALLVDVANKFESELKIIHGNKEANVKSIISLISLAIGCDDAVIIQGDGVDEEEAVAEIATIIKG |
| A0A3D2PB47 | 124-219 | DFYSLRVTIPNKRGLHLNPVSTLVSVVKGFDCDVFIHKPGLEHYNFILQGRPFLHIKSVFTLMGVAAIQGDTIEFIAYGCEAEIALE… |
| A0A4U1LZH9 | 282-382 | None |
| A0A1H6GLX4 | 229-313 | None |
| A0A2N5E221 | 2-88 | None |
| A0A842W3S9 | 9-107 | None |
| A0A1D9NZG6 | 22-94 | None |
| A0A0H3ABS5 | 13-93 | None |
| A0A7C4C7E6 | 66-156 | None |
| A0A5C8FV04 | 8-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.