DPCstruct | MC57679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 144 ± 28 aa |
| Standard deviation of domain lengths | 28.44 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 65.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02042 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1IC43 | 17-169 | LSSSPSSSSSPPPPLPNPILERSCPASVKIVPRRRKFESRNRRPPTLVSADAVRALMHLSQREAAEQLDISLTALKSACKKMGITGW… |
| A0A7S0E063 | 152-251 | SYLVHSRRGFSTQTIEITLEMLQQRFHLSLEAAASEMGIGKSTMKTICRTFGIPKWPYTHKGKKRRQTFNISNQQIDTAYDGTLLPG… |
| L1I9J5 | 3-157 | None |
| A0A7S0NEF4 | 140-276 | None |
| L1ID59 | 5-129 | None |
| L1IFP8 | 1-92 | None |
| L1IGB9 | 1-154 | None |
| L1IHV0 | 4-144 | None |
| L1IIU4 | 4-202 | None |
| L1IQ70 | 13-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.