DPCstruct | MC57669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Standard deviation of domain lengths | 18.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496K8N7 | 1-132 | MKTSKKTIFRKVKLMVPLVLLTASLGACSLISKSSAASTSTTTSSTTSKTSSSKASTASTSYFTDRDQDASYDESSATKVSLSGSTA… |
| A0A849DRH0 | 1-164 | MQRSTLKTVVPVVCAAAVLAGAFSAVAIAADEAPSTSAQLAVARVTPEQVMAANATDHDDPADYVWNAADVVPITLNGSGATSGGSG… |
| A0A3N0ILE9 | 16-144 | None |
| A0A8B2EZ71 | 1-146 | None |
| A0A3S4NG01 | 139-270 | None |
| A0A0F3H781 | 1-123 | None |
| A0A1T4PTQ5 | 1-166 | None |
| A0A800J3K1 | 3-125 | None |
| A0A428WU33 | 265-430 | None |
| A0A3D4S7Z1 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.