DPCstruct | MC57668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 124 ± 7 aa |
| Standard deviation of domain lengths | 6.62 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496K4R8 | 1-123 | VQLSHGNYITLVESKNREVRKEAYEALYSVYEQYQHTYAKTLQTNVKVHNYNAKVRKFSSAREAALSADFIPESVYDSLVSAVNKHL… |
| A0A7Y2TSM4 | 120-248 | SQGYGRYRSSENRDDRKAVFDAYWGKWQEYRNSVGAVLSAHLQTQASLAKARNYESVLHRELFQDNLPPEVYRTLVAEVNTALPTLH… |
| A0A380FDM1 | 77-190 | None |
| A0A359IDY1 | 34-148 | None |
| A0A535EQJ8 | 196-322 | None |
| A0A7C4C7P6 | 215-329 | None |
| A0A091C4W8 | 90-223 | None |
| A0A645AV86 | 113-236 | None |
| A0A090YKK0 | 192-310 | None |
| A0A3A0HNQ4 | 3-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.