DPCstruct | MC57663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 145 ± 35 aa |
| Standard deviation of domain lengths | 35.21 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07424 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q69B92 | 1-121 | MKKILFPFCVFGVINSVNALDLQLLSGDTRTSCEVILCLASPVKPPECASSLAKYFSIHFKKPWKTIQARKEFLNLCPIDTTNDPEM… |
| A0A5C7S171 | 11-165 | GQTSNMLTGDTGLACEAIICLSSGTRPGECAASLARYFSINLSKPWKTIQARLNFLQLCPSSNETPQMGTLVNAIAHGAGRCDAATL… |
| A0A6N1XBL4 | 1-160 | None |
| A0A1F1GPP4 | 1-101 | None |
| A0A1B9JRD5 | 94-319 | None |
| A0A378XMP5 | 9-177 | None |
| A0A7Z1KSZ5 | 1-86 | None |
| A0A7H9CJ42 | 2-163 | None |
| A0A2X1WIQ5 | 1-212 | None |
| A0A1C4BB89 | 11-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.