DPCstruct | MC5766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 269 ± 45 aa |
| Standard deviation of domain lengths | 45.48 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.29 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | CL0254- PF01425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0A9Q9 | 17-294 | FSSAFTPINVSRSFFLNGSPYYIGTEPVLSLPQVNLTQEILPFSVFTSNGTGTFGGADLSALVANWSAIDDVFNNSFLQAALIQSSG… |
| A0A507B1L7 | 529-836 | MGLIIRLVAFLMVLPFGAPQITSTGSTVLLNNIPYYISPHTVGNASLQPTVLDDIKAAFGFIPVSVLTAGTQLADLVDIFSAWNEAD… |
| A0A1V8S8B0 | 1-264 | None |
| A0A1B7Y7N7 | 10-304 | None |
| A0A420U281 | 10-273 | None |
| A0A0F4Z5Z1 | 5-261 | None |
| A0A2T2NYZ2 | 8-278 | None |
| A0A0F9Y451 | 17-287 | None |
| A0A0A2KGY8 | 15-247 | None |
| A0A1R3RCD5 | 1-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.