DPCstruct | MC57656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 166 ± 33 aa |
| Standard deviation of domain lengths | 32.73 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05949 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A291STE0 | 25-196 | IRSEVDALARRDNGSTEAERRKLAALEETAGTRELSGSGLTVTLTDAPPNATPKIPGVPDPQPNDLVIHQQDLQAVVNALWQGGAKG… |
| C7IQH6 | 1-135 | MVGPGVIVTVNDSDLQPRDGEDPNLYLVHDEDLLSIVNELKAGGAEAIAINNQRIIATSEIRCVGPTIIINSTRYAPPYVIKAIGDP… |
| A0A488AXM6 | 4-116 | None |
| A0A1R4F8W2 | 43-237 | None |
| W6JY06 | 17-190 | None |
| A0A1Q6L6P0 | 34-163 | None |
| A0A261F2A2 | 585-786 | None |
| K1ZMM7 | 7-196 | None |
| A0A7C6J281 | 41-235 | None |
| A0A7X9I4L7 | 4-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.