DPCstruct | MC57646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 54.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453MQQ3 | 429-510 | MVLPKHPLPTHNVVIRGGAPNAFTQSVVAYDEIQNPTLKNALVLEDAISDLPKVGNDQADDVMEYLVKPKTEFQRYIRLSRK |
| A0A453MQP6 | 312-391 | MVLPKHPLPTHNVVIRGGAPNAFTQSVVAYDEIQNPTLKNALVLEDAISDLPKVGNDQADDVMEYLVKPKTEFQRYIRLS |
| A0A0A9F609 | 33-119 | None |
| A0A5J5BBV5 | 359-437 | None |
| A0A453MQT0 | 203-284 | None |
| A0A6N2M9F4 | 659-735 | None |
| A0A6P6SPI9 | 532-611 | None |
| A0A3Q7HGP9 | 209-287 | None |
| A0A1S3EEE7 | 618-710 | None |
| A0A446S726 | 63-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.