DPCstruct | MC57641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 89 ± 13 aa |
| Standard deviation of domain lengths | 12.59 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A173U5P5 | 298-372 | NEPKMLYIFGHSLDVTDGDLLREFLERDDVKTVVFYLDNKQRRQLITNLVKILGEDAVIEKTYGNNPSIVFQKQS |
| R6M8S6 | 34-112 | LGLSEVYIFGHSLDISDKDLLEEFFLNENIVVNIFYKNKVHQANLIAAIIKMISEKIFIKQYQSYPQKIKFIQQKEMIL |
| A0A2V1JND7 | 161-240 | None |
| A0A811GJ46 | 6-118 | None |
| A0A417JV14 | 251-341 | None |
| A0A1Y4QII0 | 199-276 | None |
| R6TCL8 | 52-135 | None |
| A0A173U2W6 | 324-406 | None |
| A0A2I1YGD9 | 174-261 | None |
| A0A6L9H9E1 | 147-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.