DPCstruct | MC5764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 167 ± 22 aa |
| Standard deviation of domain lengths | 22.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A163ME06 | 5-140 | LVFASLLVHAAAQSTILYIPFYVLDTQSIDASIVAANPPATTMQLACPSGTDSNDCGLFPDMTLVYGPSTYHLDMGVGDGNAFTGTA… |
| A0A507AXJ8 | 1-180 | MSSSVLVLLSAAMAVAQITTIDVVFPVEAVGTMTGTVVNANPSLTTFAIHCANDANNAQCHILNTQTVVEGPSTLTIQYFHSSDSQA… |
| A0A0S6XMA4 | 2-204 | None |
| A0A2G8RX40 | 3-158 | None |
| A0A2G8RX50 | 19-194 | None |
| W6Q727 | 20-181 | None |
| A0A1L7W8S9 | 2-164 | None |
| A0A1V6SQC5 | 12-160 | None |
| A0A0S6XMX7 | 5-245 | None |
| A0A7J6J9F1 | 21-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.