DPCstruct | MC5763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 314 ± 55 aa |
| Standard deviation of domain lengths | 55.20 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5WYY9 | 8-327 | KSNNYDSSGKLGNPLIYGFNIPDSCDRYEFGPLAKKATGGDYDTEHILEFQLLTDFFNDVNNKWAKNHFEHPDSAEVIENTNPPERK… |
| A0A507AUG3 | 39-359 | QRPQGTFELRPRNTKSTQFGLGKGKGNQEPKVTLHFPNYPAPSQAARQSAVEKYYDFQHKNDPDYNPEMTKLNTVPSLDNFNTEHVY… |
| W6YW10 | 524-848 | None |
| A0A1Z5TCR6 | 22-294 | None |
| C4JPH8 | 44-349 | None |
| A0A6A5Y252 | 43-393 | None |
| A0A6G1IFN7 | 435-730 | None |
| A0A084R3N4 | 319-619 | None |
| A0A6A5V8E4 | 9-296 | None |
| A0A2K0ULX9 | 112-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.