DPCstruct | MC57626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 231 ± 24 aa |
| Standard deviation of domain lengths | 23.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1L8P7 | 797-1025 | GLPHGSWFPVRPGLAPDTDDGAPDWHRDVLTQPVVSALTGEQIGRSLHTPGELAGTREHNFSRLDQMTLYVHYDPATGTYSAKLPLD… |
| D9Y001 | 241-434 | VLRTIDGKTLRDADVKSVTLVDDGRPVGRAVVNGSDLIRREPWLQQLTRSTEWFVYDPVTGQPIGNPRLVPWKGRKPYFFLVHGLPG… |
| A0A378YCT9 | 44-292 | None |
| A0A7W9HJG5 | 1-250 | None |
| A0A2N7T1Q3 | 382-610 | None |
| A0A7Y8P6E7 | 444-702 | None |
| A0A3S8X069 | 33-290 | None |
| A0A7J0C0N0 | 1-208 | None |
| W7SSJ9 | 274-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.