DPCstruct | MC57612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Standard deviation of domain lengths | 12.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812W100 | 61-197 | EGVTLEQRQNAIECEGHLYAAIDFTPPQSVPDIGLDVTPRYYQPNEGSKGLTYNKIPGGWELADATDVVKEKVIKPYPWGTHLLVAK… |
| A0A813GJI5 | 129-253 | HNGNLYATIAFTSPTELPPWGWEVPHQYDTRGRTDPQVTLGNPLPPGWKLATADDEIKLKVIKPFPWGTHLLVTDGGKTYHTSKSKK… |
| A0A7S1WGD6 | 1-105 | None |
| A0A7S1SBA1 | 2-125 | None |
| A0A812RX47 | 121-242 | None |
| A0A812IBA2 | 308-434 | None |
| W7T8F1 | 489-629 | None |
| A0A7S0KTF6 | 535-649 | None |
| A0A812LBW3 | 114-240 | None |
| A0A812M4D5 | 338-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.