DPCstruct | MC57610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 213 ± 49 aa |
| Standard deviation of domain lengths | 49.18 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812VSQ1 | 485-691 | AGTLSHSLDFRKSAGGFIHGFRYTSRALFRLLEEKNFNVPWPQISWQVPLTLTCGAATGCDGDGSDPGLEPLLEMLLSRINSASGPY… |
| A0A6F8YXA0 | 4-138 | DPDELTALVLDRVNWSSALWTQFEYLCDVLVVDPATGRARHFQDLPEDHAVDRFGDQPHWYSVTLRWGRDEYPDVFNIARHPEPSRA… |
| A0A7R9FTI0 | 5-193 | None |
| A0A6L5CG85 | 192-450 | None |
| A0A1I8FRM8 | 198-381 | None |
| A0A1W2FWL0 | 44-212 | None |
| V9GJ43 | 73-274 | None |
| A0A535NRM5 | 193-400 | None |
| A0A7K2I8H1 | 2-139 | None |
| F7ARY3 | 73-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.