DPCstruct | MC57609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 154 ± 24 aa |
| Standard deviation of domain lengths | 23.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11086 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327WYK4 | 2-112 | LITLIGVGLLAEYLMVAMGAIRFTGTDLLPAWLILLWLGFAAMALVVFTWLKGRYVLAFIAGVIFGPITYFAGVGLGAAERLTSPML… |
| A0A812V7E0 | 382-525 | PQQNNGPIAVAVLAMLALVTSHSRLQLLFVIASYVFMGLVLDSIQVAFGTMSFPADSDSPTLGVLPVWFVALWANFGCVAEYLPVFK… |
| A0A559QJK9 | 5-180 | None |
| A0A812ZSU4 | 383-560 | None |
| A0A3M0CEW9 | 52-222 | None |
| A0A7W5IHS3 | 2-115 | None |
| A0A7Y3ME06 | 2-110 | None |
| A0A1E5A678 | 5-131 | None |
| A0A266Q5D9 | 11-169 | None |
| A0A2D7P9N8 | 52-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.