DPCstruct | MC57602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 246 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812T3H6 | 1-264 | MAGTHDRLCLGCGKCFAKPARLRRHLLSSAPCRKAWGSFRPDSASLPAMHALALPLRVPGVMSGGHAVIDPATYHKGLLETLQALDC… |
| A0A1Q9F1J5 | 167-401 | YRSRSFLLPEDRICRTCAKVFATVGRLRRHLTAAPRCLAHWGVFQPSAAAARYQPHAMAPPTVVPGHTVPPPAFDFSPTVSSTLLEA… |
| A0A812ZD96 | 698-932 | None |
| A0A812ZND5 | 197-410 | None |
| A0A812HZ20 | 94-351 | None |
| A0A1Q9EL94 | 207-466 | None |
| A0A1Q9EF75 | 1-255 | None |
| A0A812JMW0 | 817-1066 | None |
| A0A812YRT4 | 170-440 | None |
| A0A812PX92 | 575-824 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.