DPCstruct | MC57600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 486 |
|---|---|
| Mean domain length (aa) | 87 ± 13 aa |
| Standard deviation of domain lengths | 12.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 19.93 |
| Pfam Score | 99.22 |
| Assigned Pfam label(s) | PF02825- CL0027- CL0084- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812S3F1 | 6-91 | QRAAKRLAPCTPCWEFQVQAPDMWMQYPADAGRCLEEAYQAWKSTCTVCIHQYEYVIDFRWMTQTNQATGKGRPIRRTEDTERHAA |
| A0A4Y2QL18 | 84-155 | YQWFYEGRNGWWQYDDRTSSEIEAAFKKGEQQCEVLIAGFLYIIDFQKNLQIRRCDPYRKRRIKRDLVTIPK |
| A0A7S2KF73 | 434-509 | None |
| A0A2C9JUQ2 | 581-682 | None |
| A0A4W4FSU7 | 174-292 | None |
| A0A5P1EZZ9 | 52-124 | None |
| A0A2B4S5Y8 | 351-443 | None |
| A0A1D2N556 | 196-277 | None |
| A0A7S4S3C3 | 569-647 | None |
| S4RNL4 | 231-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.