DPCstruct | MC576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 83 ± 13 aa |
| Standard deviation of domain lengths | 13.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 52.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0EQB9 | 31-106 | LVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELHKADLYNKVSQA |
| A0A819IZ81 | 40-116 | MVRALRKLNRVIEPLKDFHKDEVRQIGLTLGLHSDVIYRHPFPGPGLAIRILCVDEPYMPVEYFSQTSSLLKTIINY |
| A0A7J4J150 | 10-83 | None |
| A0A1S3T2M2 | 15-105 | None |
| A0A7G2K0F9 | 59-128 | None |
| A0A164UT88 | 117-186 | None |
| A0A164URD1 | 19-101 | None |
| A0A164TUF3 | 63-141 | None |
| A0A164TPE9 | 1-81 | None |
| A0A164LT12 | 7-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.