DPCstruct | MC57599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 555 ± 71 aa |
| Standard deviation of domain lengths | 70.94 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812RUE4 | 81-664 | DVMFQADYFLKELALGEYTMPVVGMLSVFDWSEAMGMQDQPWAGREWFVVKKAEVHMAADKTLVPCVKMGVEAREQVVTDAGLKDVA… |
| A0A7S2GZW9 | 151-735 | EVLFQADYHLKELSMGEYDQAVNGMRNAMDWSEDSNYWDWRAREWFICQNALVERSKDGVLMPQLELAVKAKQQVVDPKTNQLVDVE… |
| A0A7S1MA25 | 1-416 | None |
| A0A813BJJ8 | 49-612 | None |
| A0A7S2PBG6 | 184-652 | None |
| A0A7S1RU35 | 1-540 | None |
| A0A7S1RU27 | 1-523 | None |
| A0A7S1WQ92 | 99-754 | None |
| A0A7S1WM33 | 1-519 | None |
| A0A7S4WJS4 | 454-1116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.