DPCstruct | MC57596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 119 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0F081 | 48-158 | IETSGIQKLLMQIGIPANMLGFSYIVTALELIALDPDYLNNITKGLYVDVAKKCSSTAARVERNIRHAIEIGFLKGDLEEIEKIFHC… |
| R5RKP8 | 4-110 | VESLPFSLGIRTNYKGYYYLVDALTLIMEDENRLLSIGTELFPAIALKYQTDVRCIERNIRTVIKVCWESTACQKLQSISPYPLESP… |
| A0A354WKB6 | 3-113 | None |
| A0A1H9U522 | 39-158 | None |
| A0A7Y6BTB3 | 70-190 | None |
| A0A7G9G0N3 | 2-110 | None |
| A0A1H7NCB6 | 76-185 | None |
| A0A6N7SMX5 | 43-168 | None |
| B0G1R6 | 9-115 | None |
| A0A3A6FE20 | 2-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.