DPCstruct | MC57594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 97 ± 16 aa |
| Standard deviation of domain lengths | 15.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165XE84 | 3-80 | EYPQNLTEELRDVLGLMIMQTCPIAHALRRGGEDIPHKTEAEQAYVLHWLIGLTLEHGEGWREKVGERLQHIAADARA |
| A0A1X0N9V3 | 28-114 | SAAVQELRDLIISPTHLPLDDDLRYILGRANFSCMSIAQGLRLLGYDIPENSEDEQAVAIHWMLSHYLRDPANWRQNASQEFHSKSE |
| A0A411T3F0 | 120-208 | None |
| A0A833QGE2 | 452-560 | None |
| I2IPA3 | 166-240 | None |
| A0A0J5WFW9 | 4-77 | None |
| A0A0Q5HMY0 | 36-123 | None |
| A0A3N8XTW5 | 192-279 | None |
| A0A831YP82 | 177-277 | None |
| A0A2L0WYQ0 | 80-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.