DPCstruct | MC57591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 166 ± 36 aa |
| Standard deviation of domain lengths | 35.72 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF00191- PF04424 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2RZ19 | 395-519 | MQDIVKAVGNCSYNQLVEKIISCKQSDNSELAGEGIVAEQFLSSTATQLTYHGLCELTSTVQEGELCVFFRNNHFSTMIKFKGQLYL… |
| A0A3L6TEE6 | 21-156 | KIVQDFLKEAKKLCTRYGYLKLCEMANGSFALYYWNKKLDVIHKNETYLLILETDQGVLDKLPGVTWRVFEEVDDGNSIYLASDYSL… |
| A0A7S1MQ28 | 1-176 | None |
| A0A7S2SZU8 | 351-488 | None |
| A0A7J6LSN2 | 504-670 | None |
| A0A1J3GG80 | 338-461 | None |
| A0A0D8XV43 | 252-426 | None |
| A0A0E0HVH7 | 282-422 | None |
| A0A2H3CR86 | 1-120 | None |
| A0A2H3CLE5 | 85-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.