DPCstruct | MC57585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 187 ± 13 aa |
| Standard deviation of domain lengths | 13.39 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1MWF3 | 131-328 | PETPTPAPKPPPPENGVDEKMGADTLQKTLDKDKRINAQLNPVGDSQLAKNVANALLELKEGDSASPSPMVQVPKDSTLGKWLSLAE… |
| A0A1B5EW97 | 13-192 | NLSPSPDYLSQAQSMGLKASQTLAANLINTLSVALGPTPPRSLHELRVTIPEDSLLSSWLAVYWKAINQPAFLDWADALDLDLPTLF… |
| A0A7Y8DJ48 | 125-333 | None |
| A0A8B4I964 | 31-218 | None |
| A0A7D5LNV5 | 1-172 | None |
| A0A554T8E9 | 38-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.