DPCstruct | MC57584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 360 |
|---|---|
| Mean domain length (aa) | 256 ± 49 aa |
| Standard deviation of domain lengths | 48.81 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 14.94 |
| Pfam Score | 35.94 |
| Assigned Pfam label(s) | PF10496- CL0559- CL0154- PF05600- PF09495 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6PIB1 | 7-253 | EAGRPLNSRRDKQDPTQALASGIFQINTAVSTFQRLVNTLGTPKDTPELRDKLHKTRLHIGQLVKDTSAKLKQASENDHRIEVSASK… |
| A0A453K1K9 | 2-182 | LETLTKLLKDLQNSNEESKIVTKASAMKDIKRRMEKDVNEVTKVARLTKSKLQQLNKENLANREKPVFHKGSSVDRSRTSVTITLTM… |
| A0A0V0QVK7 | 5-290 | None |
| B4DSX3 | 6-169 | None |
| T1N679 | 213-503 | None |
| A0A3N4I9C4 | 42-334 | None |
| A0A7R9Y9Q6 | 29-287 | None |
| S7RHZ5 | 13-277 | None |
| A0A7S2SJP4 | 1-400 | None |
| A0A182FKP8 | 21-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.