DPCstruct | MC57581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 308 ± 61 aa |
| Standard deviation of domain lengths | 61.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433QAY0 | 13-341 | LIPFAIVVFVHLISSLGPWMEPIQAACKNPELAAQQGIRTIYTDVAPIDGFLCWIVPFFQESLKTPAAFVVHCYLYTVANTYFGLAA… |
| A0A5N7A5U9 | 170-464 | MAFFRLAYLSASLNAPTPKTLQVLQYFGCMGSAWIVMIMESCRHKSFAQILNQISIWGLACMFVGPNLILPLYYTVNFPDGRPDSQE… |
| A0A365NBX4 | 13-336 | None |
| A0A1L9U925 | 23-272 | None |
| A0A194VKW0 | 5-351 | None |
| W9WQK8 | 141-357 | None |
| B8BRW8 | 10-344 | None |
| J4U9Y5 | 23-375 | None |
| A0A0D2GMS1 | 2-188 | None |
| R1EUU5 | 5-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.