DPCstruct | MC5758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 276 |
|---|---|
| Mean domain length (aa) | 249 ± 49 aa |
| Standard deviation of domain lengths | 48.64 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.81 |
| Pfam Score | 31.38 |
| Assigned Pfam label(s) | PF09955- PF06161- PF04515- PF10110- PF04854 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2NKN0 | 1-212 | MRVRDIKRDARAALKGQWGFAVLVSFLALFIYSAVPIVIESIISGGFWDFIYDETALSAALGYILPIFLFPILMGHYWVYLSMVRRE… |
| A0A1V5K872 | 6-247 | PSPPTQLRSRPRLVDALRLFIKASGLTYENLGMSLVLSIVWFFAVATAAAFVNVAPIIVPLAIVLVSPIHAATAAWANLVVHRDDAG… |
| A0A356BVR9 | 137-360 | None |
| A0A1E5KV40 | 152-314 | None |
| A0A353RV55 | 7-236 | None |
| A7B5V5 | 2-157 | None |
| A0A2E8R8D0 | 9-268 | None |
| A0A6G6WTF2 | 3-287 | None |
| A0A4V1CWP8 | 41-373 | None |
| A0A6J4NJ86 | 25-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.