DPCstruct | MC57569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 144 ± 17 aa |
| Standard deviation of domain lengths | 16.90 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 29.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B7YSR1 | 1-143 | MPRTRGWIWPKDPRPGNFAKWKRGSRLRDILTNKGPDIFVGTLDGHIPVPRRPRWSRWQDVLGYDGDGSEEKRESMPWARRRNQRYN… |
| A0A1V8V6A8 | 197-349 | MPRNWRPKHYFTRPSDGKRPGFLGRLKDVAQSEGADVFITTSGDKRTLMRDRPQRYDWAGWGMDPWELWERQMLDPDGRLQDQMLIS… |
| A0A6G1G567 | 19-147 | None |
| A0A6A6SB61 | 48-177 | None |
| A0A6A5R1P3 | 30-180 | None |
| A0A1L9PZB5 | 111-284 | None |
| A0A399GAZ8 | 2-124 | None |
| A0A517LI69 | 32-161 | None |
| A0A1V8TH37 | 64-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.