DPCstruct | MC57564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 148 ± 24 aa |
| Standard deviation of domain lengths | 23.59 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I7MX53 | 17-121 | PNAMVAKLLYPESQWGEEISIYVNVTDGNYCFEAIDFYGNDIKLNPETVKKIPTLQELIFLIETMDVNPETAQGNVELTLSGIPEAE… |
| A0A3E1EMM2 | 30-173 | QAIRTDGLGSIPAAWTAHDISEILKGMLQAQHPTARGGEDLPDLEDDEVEIARMTLANSVHGEVTSLRAAPGATPGEIVFRMVDEYE… |
| A0A660VMU8 | 45-203 | None |
| A0A4Q3UCE7 | 54-200 | None |
| A0A7U4Z8J6 | 1-173 | None |
| A0A838DER4 | 1-176 | None |
| A0A7W1BJB2 | 44-220 | None |
| A0A2E0YHZ1 | 17-133 | None |
| A0A522LXJ4 | 57-226 | None |
| A0A651E054 | 40-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.