DPCstruct | MC57562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 117 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B6X7P5 | 12-124 | DLSPSQEAPGLAPERVRGAGGYFRPQSAEVLLVTSERGQYLRQLWENSALPAGLYQQFYLDPLRQLCARVQHVPATQEGIWSYRGGF… |
| A0A2X4T0G6 | 1-94 | MNASELLATTRRQQWLQLLWDYSSLPKEMYRQYYLAPLEHCVTLMQQFPLTESGPYARPGGMADYMLETVSYAARLSKSYMLPVGAP… |
| A0A2Z3I419 | 10-119 | None |
| A0A4R0XMQ7 | 4-132 | None |
| A0A1R3FDF5 | 13-135 | None |
| A0A2X2C949 | 11-135 | None |
| A0A1H8V7M7 | 3-117 | None |
| A0A7D5YR87 | 9-135 | None |
| A0A370DTZ6 | 60-173 | None |
| A0A849SJT3 | 18-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.