DPCstruct | MC57561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0XL97 | 96-163 | RKRIIVAITGATGAVLGIRALQQLRRLNVETHLIISKWAAETIKFETDYTAAGVRALADFTYNPHDLA |
| A0A2V2L5Y4 | 3-83 | GPERITLAMTGASGAQYGLRLLDCLVREDREVHFLISKAAQLVMATETDVVLPAKPQAMQAFLTEYTGAADGQIRVYGKED |
| A0A0D2HHP4 | 1-62 | None |
| A0A5V4GKA9 | 1-70 | None |
| A0A0C3GQX4 | 411-480 | None |
| A0A0M3CBK0 | 1-77 | None |
| A0A1C5YD07 | 1-77 | None |
| A0A2V5HTR0 | 39-103 | None |
| A0A485CWL5 | 2-70 | None |
| W7TGF3 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.