DPCstruct | MC5756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 1 aa |
| Standard deviation of domain lengths | 1.23 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 91.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 48.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0GGH3 | 258-331 | QQIWSGWSWRTRPVIVEINGRRLAASANGMPHSIQTITNNNFNGHFCIHFQNSTRHKDNLQQADHQQNVLTAAG |
| A0A1V5K2Y2 | 1-76 | MKKIYGGKWSWDRRAVVVVVGSRRMAGSINGMPHGGQAITGNDFDGHFCVHFLNSKTHGSNAVDATHQKMVQAAAN |
| A0A7C6FL43 | 344-418 | None |
| D7CLY6 | 192-265 | None |
| A0A4Q0VNE5 | 414-488 | None |
| A0A7X9KYX5 | 874-945 | None |
| A0A840QMF4 | 725-799 | None |
| A0A7C6S8N0 | 192-267 | None |
| A0A841PXR3 | 584-657 | None |
| A0A0F2Q1J6 | 177-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.