DPCstruct | MC57554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 154 ± 17 aa |
| Standard deviation of domain lengths | 16.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W2A6I8 | 2-147 | FLAIIQFIFFIIFLVVGALFMNTLAKTLKLVRFENRKIHPDQVWLLFVPIFNYYWLFRTVAGVSESIDTEYKRRGLPSPIATATWIG… |
| A0A1V6JXU0 | 18-160 | AVPFRLTGGEILVVSWFCCAVAAVVSYCLILHKLWTLIPANTARTTPVKAVGLLFIPLFNFYWNFVAFHGLAESLNALLKKSSIRDR… |
| A0A7V2NL81 | 7-141 | None |
| A0A2E4ZY55 | 23-179 | None |
| A0A316FGG5 | 278-449 | None |
| A0A1Q3N148 | 2-124 | None |
| A0A2N2YIP0 | 111-286 | None |
| A0A0K1QE57 | 4-188 | None |
| A0A2Z3H6Y7 | 11-148 | None |
| A0A3M8FXH2 | 150-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.