DPCstruct | MC5755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 152 ± 29 aa |
| Standard deviation of domain lengths | 29.07 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.57 |
| Pfam Score | 98.68 |
| Assigned Pfam label(s) | CL0323- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4YQM8 | 188-273 | RVSDQLCDEEKEFLARRKKVATAALARYLGLEEQDINPEDVPTIAVCGSGGGLRALVAGTGSLLAIQEDGLLDCVTYTSGVSGSCW |
| A0A1D2VJB9 | 103-274 | RNISASNEDENDNQYNHYNPIKNYAPYTTLCPLNERLVRSAYFDGLNQPSSQLSLSLEEQNYIANRQQKTQVALENYLNRISIDGFN… |
| A0A178EP78 | 1-124 | None |
| A0A4U0VD14 | 27-161 | None |
| A0A5N6ERM0 | 7-159 | None |
| A0A2K0W9C8 | 8-146 | None |
| A0A420NJB4 | 8-159 | None |
| A0A0F4YG37 | 2-147 | None |
| X0GUP1 | 12-162 | None |
| B8P601 | 34-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.