DPCstruct | MC57546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 136 ± 23 aa |
| Standard deviation of domain lengths | 22.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 40.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0G7U0 | 7-131 | RNKLDSAMAVSHLPNDYPAVFLEVTVDDSSDFETALEVHGLYRHGYSVLEVHGPVVPNTIASVLLHIRDVTGLMPHIYFRRTEGNPV… |
| A0A329YWE6 | 30-159 | AAEEYKASLTSTIEARELPAEHQPLFLDVVIDTANKFEAGLPVHGVIRHGYRVLEAHGPAAPKTIAAVLLHIRDVTGLVPHLYFTRS… |
| A0A1C6M9W2 | 5-103 | None |
| A0A154V210 | 1-89 | None |
| A0A810NSN5 | 32-180 | None |
| A0A2H1HVG2 | 18-131 | None |
| A0A142XNJ2 | 129-285 | None |
| A0A399EXT1 | 230-386 | None |
| A0A640UC25 | 384-542 | None |
| A0A1F1L1S9 | 428-577 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.