DPCstruct | MC5754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 155 ± 22 aa |
| Standard deviation of domain lengths | 21.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9V6H3 | 19-148 | SKVAITLNNRCQDLLRESLTFICNDTYPEEAKKSYSDGLVHVNLSYSVYKINGRHNAYFITHGKSSISACRTLIVKDDEVFKCDGKS… |
| B5DQV1 | 69-240 | KIVLLLLLLAGAYNGLHVPNYNEGDCDFIYKIRLMRVCKSTVSKRIAATYADVRAPSGTPYSLWVVPNATDMILASFHSSKLLNRKY… |
| A0A1B0BM51 | 23-166 | None |
| A0A3F2Z4M0 | 208-332 | None |
| A0A0A1XT75 | 13-170 | None |
| A0A1A9Z4D5 | 36-174 | None |
| A0A6P4I4N8 | 10-155 | None |
| A0A1A9XND9 | 20-182 | None |
| A0A1A9ZP49 | 53-221 | None |
| A0A3B0J4D7 | 17-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.