DPCstruct | MC5753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 11 aa |
| Standard deviation of domain lengths | 10.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11467 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0Z5S0 | 100-251 | EPNKVDQINLLLTEVNLLDYVNKLCSALSINYSKLNYEIALKSLEQISELQFNALMLKKHRCIIDKITKVTKYVGDVHNWSLSSQES… |
| B5DJG2 | 1-167 | MKDILKLENALTIERDFSDLCAKIRQCLPVRQAHVTKCLKNLGRLKKLELTKVMLLRHPESVDTLRKLQGYVGNLKKWKMPRSDKIK… |
| B4JES3 | 78-234 | None |
| A0A3Q0INQ5 | 98-254 | None |
| A0A7J6Z528 | 843-1016 | None |
| J9JRV5 | 57-233 | None |
| A0A1W4UT15 | 36-188 | None |
| A0A2S2P2J1 | 381-548 | None |
| A0A2S2QMQ7 | 1-166 | None |
| T1IAJ2 | 291-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.