DPCstruct | MC57524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 93 ± 11 aa |
| Standard deviation of domain lengths | 11.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5ZRG4 | 1-86 | MEYISPELDEKYFVADATTSTDKYNNITSKRVAARHFDNMVTLHVKDITHVDINPSQIFSPNTSLIPFLDHNDAVRASMGTNQNRQ |
| A0A426H4V6 | 221-322 | EPVVYLSAEDEDGKTLAQANAQYDDKGNFIDEKVKARYEGDFPVIEPEKLDYMDVAPNQITSIAASLIPFLEHDDANRALMGSNMQR… |
| A0A6J5VLD4 | 2-74 | None |
| A0A6C9IL15 | 172-270 | None |
| A0A2I0A355 | 2-74 | None |
| R5BSD2 | 1-97 | None |
| K9IBL6 | 370-474 | None |
| A0A816JKZ5 | 176-258 | None |
| A0A7T0BRP2 | 379-455 | None |
| A0A0H1RSS3 | 290-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.